PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P31710_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 286aa    MW: 31810.8 Da    PI: 9.8485
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P31710_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18140194256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F++++ ++ ++++ LA +l+L  rqV vWFqNrRa+ k
  GSMUA_Achr6P31710_001 140 RKKLRLTKEQSALLEDRFREHSSLDPKQKQALAGQLNLRPRQVEVWFQNRRARTK 194
                            788899***********************************************98 PP

2HD-ZIP_I/II116.61.4e-37140227188
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq++lLE+ F+e++ L+p++K++la +L+l+prqv+vWFqnrRARtk+k++E++ye+L++++++l++en+rL+ke +eL+
  GSMUA_Achr6P31710_001 140 RKKLRLTKEQSALLEDRFREHSSLDPKQKQALAGQLNLRPRQVEVWFQNRRARTKLKKTEVEYERLRKCCETLRDENRRLQKELQELK 227
                            69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-18134197IPR009057Homeodomain-like
PROSITE profilePS5007116.763136196IPR001356Homeobox domain
SMARTSM003892.9E-15138200IPR001356Homeobox domain
PfamPF000465.1E-16140194IPR001356Homeobox domain
CDDcd000861.90E-15140197No hitNo description
Gene3DG3DSA:1.10.10.601.3E-17140194IPR009057Homeodomain-like
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PfamPF021832.6E-7196228IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-15196239IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MHSFLCSHPA VSRKETLMDT SDRDDVRVAG LSLRLNYDGR GDLSGGDHHP RPSAGFKLER  60
SSSTATSVEP YLTLGLPGDG WGSAKAQAEE DKACSASRVV GRPSSPHSMV SSFSGGHLSR  120
IKRERDARVS DEEEDGGAAR KKLRLTKEQS ALLEDRFREH SSLDPKQKQA LAGQLNLRPR  180
QVEVWFQNRR ARTKLKKTEV EYERLRKCCE TLRDENRRLQ KELQELKSFK LLRPRYMQLP  240
ATAVSGFTMC PSCSTVAAAS DSDESGSLVV APKPRLFNPF AHSASL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406757.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-65HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLM0TBW60.0M0TBW6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31710_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-66HD-ZIP family protein